CoreQ Academy My progress

Command encyclopedia

Linux commands

Executable 79 commands run in the simulator today. Reference only 145 more are planned and will be enabled once implemented and tested.

Files and navigation

Strip directory from a path

Change the current directory

Copy files and directories

Strip the last component from a path

Estimate disk usage

Guess a file type

Search for files in a directory tree

Create links (simulator supports symbolic links with -s)

List directory contents

Create directories

Move or rename files

Print the current working directory

Print the target of a symbolic link

Print the absolute path

Remove files or directories

Remove empty directories

Show file status

Create empty files or update timestamps

Show a directory tree

Text processing

Pattern scanning (simulator supports '{print $N,...}' with -F)

Print file contents

Select fields or characters from each line

Search for lines matching a pattern

Print the first lines of input

Reverse the characters of each line

Stream editor (simulator supports s/OLD/NEW/[g] and -i)

Print lines in reverse order

Print the last lines of input

Copy input to files and standard output

Translate or delete characters

Collapse adjacent duplicate lines

Count lines, words and bytes

Shell

Define or list aliases

Clear the terminal screen

Print environment variables

Set an environment variable

Do nothing, unsuccessfully

List the commands available in this simulator

Show command history

Show the manual entry for a command

Print all or one environment variable

Format and print text (supports %s, %d, \n, \t)

Print a sequence of numbers

Pause (instant in the simulator)

Do nothing, successfully

Describe how a name would be interpreted

Remove an alias

Remove an environment variable

Show the path of a command

Users and permissions

Change file group

Change file permissions

Change file owner and group (requires root)

Look up passwd or group entries

Create a group (requires root)

Print group memberships

Print user and group IDs

Run a command as root (student is in the sudo group)

Create a user account (requires root)

Modify a user account (requires root)

Print the current user name

Processes and services

journalctl run

Show simulated service logs

Send a signal to a process

Find process IDs by name

Signal processes by name

systemctl run

Inspect and control simulated services

Show a snapshot of the busiest processes

Networking (lab hosts only)

Fetch a URL from a fictional lab host

Show network interfaces and routes (simulated)

Check reachability of a lab host (fictional network only)

System information

Print the system date and time

Report filesystem space usage (simulated values)

Show memory usage (simulated values)

Show the system host name

Print system information

Show how long the system has been running

Planned (reference only)

Filesystem and navigation: locatewhereislsblkmountumountmktemptruncate

Files and text processing: lessmoreegrepfgreprgxargssplitjoincommdiffcmppatchstringsodhexdumpxxdfoldfmtpasteshuf

Shell and scripting: bashshsetsourcetestexprbctimetimeoutwatchcommandreadgetoptstrap

Users, permissions and identity: whowlastpasswdsuuserdelgroupmodgroupdelumaskgetfaclsetfaclchagelastlogvisudo

Processes and services: htopkillallnicerenicejobsbgfgnohupdisownvmstatiostatsardmesgservicecrontabatlsofstraceulimithostnamectl

Networking: ifconfigtracepathtraceroutemtrdignslookuphostresolvectlssnetstatwgetncncattelnetsshscpsftprsynctcpdumptsharkethtoolnmclinmtuinftiptablesufwfirewall-cmdroutearparpingiperf3

Packages, compression and security tools: aptapt-getdpkgdnfyumrpmpacmansnapflatpaktargzipgunzipbzip2xzzipunzipzstdsha256summd5sumgpgopensslbase64jqyq

Development and infrastructure CLI: gitpython3pipnodenpmnpxdockerpodmankubectlhelmterraformansiblemakegccnvidia-smi